PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr020751.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 320aa    MW: 35808.9 Da    PI: 8.1302
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr020751.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+++++++G+g +W + +++ g++R++k+c++rw++yl
      Pbr020751.1 14 KGPWSPEEDAKLKEYIERYGTGgNWISLPQKAGLKRCGKSCRLRWLNYL 62
                     79*********************************************97 PP

2Myb_DNA-binding42.21.9e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++ eEd ++ ++++  G++ W+ Ia+ ++ gRt++++k++w++
      Pbr020751.1  69 GEFSDEEDNIICNLFTNIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.039962IPR017930Myb domain
SuperFamilySSF466893.36E-2711109IPR009057Homeodomain-like
SMARTSM007171.4E-121364IPR001005SANT/Myb domain
PfamPF002491.1E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-241569IPR009057Homeodomain-like
CDDcd001675.64E-91662No hitNo description
PROSITE profilePS5129421.77963117IPR017930Myb domain
SMARTSM007173.1E-1167115IPR001005SANT/Myb domain
PfamPF002493.8E-1169111IPR001005SANT/Myb domain
CDDcd001672.00E-770113No hitNo description
Gene3DG3DSA:1.10.10.601.1E-2370117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDAKLKEYIE RYGTGGNWIS LPQKAGLKRC GKSCRLRWLN  60
YLRPNIKHGE FSDEEDNIIC NLFTNIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLMGI  120
SFLPSQRLKS HSSSYQGSNT STSYYTQTRS FTNTLDPISF SQSLMSSTST NAAAASALQV  180
PQESFVGRHM HQQHYQVKDN ILMFGGEASC CSSDGSYSNH QIREREYEYG GAYGGAGGGS  240
TNGEVKLHMG LKNYNCFTGF GGEQKIMENN SSGNSEMWED QARLDYGLEE IKQLISSTGS  300
CNNFLFDENK TQEKVMMYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25111174108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009377015.10.0PREDICTED: transcription factor RAX2
TrEMBLM5VQA21e-149M5VQA2_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s12530.11e-117(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.12e-76myb domain protein 68